Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G088700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000054 |
| Alias | Chr01:9578325|9578870 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 9578325-9578870 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G088700 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G088700.5:4 Gorai.001G088700.1:4 Gorai.001G088700.6:2 Gorai.001G088700.3:4 Gorai.001G088700.2:4 Gorai.001G088700.4:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.115384554 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9578497-9578869(-) 9578803-9578495(+) |
| Potential amino acid sequence |
MEDALMALEFVKNIHDMMVSKGYKF*(-) MVKTFGLFLHTSVNFFCIFSCPRICTPCSPSCHECFSQTPKPLEHPP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |