Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0739900_circ_g.1 |
| ID in PlantcircBase | osa_circ_016478 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30931120-30931508 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0739900 |
| Parent gene annotation |
Similar to microtubule-associated protein TORTIFOLIA1. (Os02t073 9900-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0739900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.396426157 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30931481-30931213(+) 30931456-30931158(+) 30931504-30931480(-) |
| Potential amino acid sequence |
MPFSDFPINFLTLVKSNPFFCLPEQSLFSQQTKCSAQLTGW*(+) MYPCLQRIHAILRFPHKFLDFGKVKSFLLPS*(+) MGKSENGMNSLETRVHGLEMALDEISRDLAASSGRTSNSEAHVNSCCILNPKFWRRHDASRYSS SFSVSDGRNSSEGSRTSYKWGRQKFGVQGGFVTNPLAEPNISSAARTATAQEGRRKDLTLPKSR NLWGNLRMA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |