Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0192400_circ_g.5 |
ID in PlantcircBase | osa_circ_036251 |
Alias | Os08circ04430 |
Organism | Oryza sativa |
Position | chr8: 5402997-5403846 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl |
Parent gene | Os08g0192400 |
Parent gene annotation |
Similar to DRP1 protein. (Os08t0192400-00) |
Parent gene strand | - |
Alternative splicing | Os08g0192400_circ_g.2 Os08g0192400_circ_g.3 Os08g0192400_circ_g.4 Os08g0192400_circ_g.6 Os08g0192400_circ_g.7 |
Support reads | 2/2 |
Tissues | leaf/anther |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0192400-00:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.119138686 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5403483-5403844(-) |
Potential amino acid sequence |
MKKINAKKKKKVVPKLEDDSKTDKYSDQQSPSKQTDIPDELETGEKTIRKSTRTSVIVRQAERE AIRAEKEATMKVKKKEGEEKRMTQEEMLLEAAETG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |