Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0192400_circ_g.5 |
| ID in PlantcircBase | osa_circ_036251 |
| Alias | Os08circ04430 |
| Organism | Oryza sativa |
| Position | chr8: 5402997-5403846 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, SMALT, Segemehl |
| Parent gene | Os08g0192400 |
| Parent gene annotation |
Similar to DRP1 protein. (Os08t0192400-00) |
| Parent gene strand | - |
| Alternative splicing | Os08g0192400_circ_g.2 Os08g0192400_circ_g.3 Os08g0192400_circ_g.4 Os08g0192400_circ_g.6 Os08g0192400_circ_g.7 |
| Support reads | 2/2 |
| Tissues | leaf/anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0192400-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119138686 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5403483-5403844(-) |
| Potential amino acid sequence |
MKKINAKKKKKVVPKLEDDSKTDKYSDQQSPSKQTDIPDELETGEKTIRKSTRTSVIVRQAERE AIRAEKEATMKVKKKEGEEKRMTQEEMLLEAAETG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |