Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0139300_circ_g.1 |
ID in PlantcircBase | osa_circ_010454 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 1906490-1907044 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0139300 |
Parent gene annotation |
Similar to Cytochrome P450 90A1 (EC 1.14.-.-). (Os12t0139300-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0139300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.126746817 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1906974-1906507(+) |
Potential amino acid sequence |
MNISVCSPEYSTNNVTHTECLIYHLKRVTR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |