Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g014110.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003558 |
Alias | 12:4929235|4929511 |
Organism | Solanum lycopersicum |
Position | chr12: 4929235-4929511 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc12g014110.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc12g014110.1.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.725557341 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4929360-4929249(+) 4929499-4929249(+) |
Potential amino acid sequence |
MKDFDTSHDHQVEMSEFIAGVTKWLTEARGSEAPSPEAGPDTMKYLDDLHEAIQRN*(+) MTCMRLFNAIDENEDGHLSRTELKALVVGIRLEEINLHENDAVEKLMKDFDTSHDHQVEMSEFI AGVTKWLTEARGSEAPSPEAGPDTMKYLDDLHEAIQRN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Yin et al., 2018 |