Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0286351_circ_g.2 |
ID in PlantcircBase | osa_circ_030565 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 10345811-10346712 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0286351 |
Parent gene annotation |
Armadillo-type fold domain containing protein. (Os06t0286351-01) ;Similar to AF-4 domain containing protein-like protein. (Os06t0 286351-02);Similar to AF-4 domain containing protein-like protei n. (Os06t0286351-03);Similar to AF-4 domain containing protein-l ike protein. (Os06t0286351-04) |
Parent gene strand | - |
Alternative splicing | Os06g0286351_circ_g.1 Os06g0286351_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0286351-01:3 Os06t0286351-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.11929454 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10346702-10345858(+) 10346521-10345854(+) |
Potential amino acid sequence |
MCCALYRRVITCNNFPLFFS*(+) MNQKIPQHLHKISYPTATKLLFSFQSGPHCLCHVLCTLQAGHHLQQFPTFL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |