Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0286351_circ_g.2 |
| ID in PlantcircBase | osa_circ_030565 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 10345811-10346712 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0286351 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os06t0286351-01) ;Similar to AF-4 domain containing protein-like protein. (Os06t0 286351-02);Similar to AF-4 domain containing protein-like protei n. (Os06t0286351-03);Similar to AF-4 domain containing protein-l ike protein. (Os06t0286351-04) |
| Parent gene strand | - |
| Alternative splicing | Os06g0286351_circ_g.1 Os06g0286351_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0286351-01:3 Os06t0286351-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.11929454 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10346702-10345858(+) 10346521-10345854(+) |
| Potential amino acid sequence |
MCCALYRRVITCNNFPLFFS*(+) MNQKIPQHLHKISYPTATKLLFSFQSGPHCLCHVLCTLQAGHHLQQFPTFL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |