Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0180800_circ_g.15 |
| ID in PlantcircBase | osa_circ_000546 |
| Alias | Os01circ03901 |
| Organism | Oryza sativa |
| Position | chr1: 4258097-4258243 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ei-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os01g0180850 |
| Parent gene annotation |
Hypothetical protein. (Os01t0180850-00) |
| Parent gene strand | - |
| Alternative splicing | Os01g0180800_circ_g.13 Os01g0180800_circ_g.14 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0180800-01:1 Os01t0180800-03:1 Os01t0180850-00:1 Os01t0180800-01:1 Os01t0180800-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011264 |
| PMCS | 0.346620295 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4258189-4258121(+) 4258151-4258161(-) |
| Potential amino acid sequence |
MVRMRPKECMLLSLKNLKSCMTSTMIL*(+) MNASLSSAVTKSLYLSYSFLSSSSLATYTPLVSSSPSSYNQSSTS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |