Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0180800_circ_g.15 |
ID in PlantcircBase | osa_circ_000546 |
Alias | Os01circ03901 |
Organism | Oryza sativa |
Position | chr1: 4258097-4258243 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ei-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os01g0180850 |
Parent gene annotation |
Hypothetical protein. (Os01t0180850-00) |
Parent gene strand | - |
Alternative splicing | Os01g0180800_circ_g.13 Os01g0180800_circ_g.14 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0180800-01:1 Os01t0180800-03:1 Os01t0180850-00:1 Os01t0180800-01:1 Os01t0180800-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011264 |
PMCS | 0.346620295 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4258189-4258121(+) 4258151-4258161(-) |
Potential amino acid sequence |
MVRMRPKECMLLSLKNLKSCMTSTMIL*(+) MNASLSSAVTKSLYLSYSFLSSSSLATYTPLVSSSPSSYNQSSTS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |