Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0592600_circ_g.5 |
ID in PlantcircBase | osa_circ_029187 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 29531318-29531428 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0592600 |
Parent gene annotation |
Translation initiation factor 2 related domain containing protei n. (Os05t0592600-01);Hypothetical conserved gene. (Os05t0592600- 02);Hypothetical conserved gene. (Os05t0592600-03) |
Parent gene strand | - |
Alternative splicing | Os05g0592600_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0592600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.419891667 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29531352-29531425(+) 29531325-29531320(-) |
Potential amino acid sequence |
MEYTVDQHNINCSTMTFNNLDFQHGTLHPTHNYLISFMEYTVDQHNINCSTMTFNNLDFQHGTL HPTHNYLISFMEYTVDQHNINCSTMTFNNLDFQHGTLHPTHNYLISFMEYTVDQHNINCSTMTF NNLDFQHGT(+) MQCTVLEVKVVEGHGTTVDVVLVNGILHEGDQIVVCGMQCTVLEVKVVEGHGTTVDVVLVNGIL HEGDQIVVCGMQCTVLEVKVVEGHGTTVDVVLVNGILHEGDQIVVCGMQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |