Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G05350_circ_g.6 |
| ID in PlantcircBase | ath_circ_019850 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 1529909-1530256 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT3G05350 |
| Parent gene annotation |
AT3g05350/T12H1_32 |
| Parent gene strand | - |
| Alternative splicing | AT3G05350_circ_g.2 AT3G05350_circ_g.3 AT3G05350_circ_g.4 AT3G05350_circ_g.5 |
| Support reads | 3 |
| Tissues | inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G05350.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.303681869 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1529996-1529911(-) |
| Potential amino acid sequence |
MRAGNPGVPTASEWIADVLAPGGRVGIDPSEFIAECYARRAYISGFTGSAGTAVVTKDKAALWT DGRYFLQAEKQLNSSWILMRAGNPGVPTASEWIADVLAPGGRVGIDPSEFIAECYARRAYISGF TGSAGTAVVTKDKAALWTDGRYFLQAEKQLNSSWILMRAGNPGVPTASEWIADVLAPGGRVGID PSEFIAECYARRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLNSSWILMRAGNPGVPT ASEWIADVLAPGGRVGIDP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |