Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0255500_circ_g.10 |
ID in PlantcircBase | osa_circ_018941 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8219433-8219601 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0255500 |
Parent gene annotation |
Similar to Phosphoenolpyruvate carboxykinase 4 (EC 4.1.1.49) (Fr agment). (Os03t0255500-01);Similar to Phosphoenolpyruvate carbox ykinase. (Os03t0255500-02) |
Parent gene strand | - |
Alternative splicing | Os03g0255500_circ_g.1 Os03g0255500_circ_g.2 Os03g0255500_circ_g.3 Os03g0255500_circ_g.4 Os03g0255500_circ_g.5 Os03g0255500_circ_g.6 Os03g0255500_circ_g.7 Os03g0255500_circ_g.8 Os03g0255500_circ_g.9 Os03g0255500_circ_g.11 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0255500-02:1 Os03t0255500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.3072 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8219546-8219437(+) |
Potential amino acid sequence |
MASMIFLVYGSLIRLPTPYGVDRVEDFRRDAVDFSGDLQAKHLRLLVVGGEELTGVDGVDDLPG IRQPDPLANSVRC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |