Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA018898_circ_g.3 |
ID in PlantcircBase | osi_circ_005925 |
Alias | 5:1581325|1581985 |
Organism | Oryza sativa ssp. indica |
Position | chr5: 1581325-1581985 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA018898 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA018898_circ_g.1 BGIOSGA018898_circ_g.2 BGIOSGA018898_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA018898-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1581973-1581574(-) 1581737-1581331(+) |
Potential amino acid sequence |
MGLGYMYHCIAMEEISRASGSVGLSYGAHSNLCINQLVRHGSPAQKLKYLPKLISGEHVGALAM SEPNSGSDVVSMKCKAEKVDGGYVINGNKMWCTNGPSAQTLRSMVGWGSATCTTALPWRRSAGR PARSACLTALTPTSALTSWSGMAALPKSSSTYQS*(-) MPDQLVNAEVGVSAVRQADRAGRPADLLHGNAVVHVAEPHPTILLSV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |