Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0926800_circ_g.1 |
ID in PlantcircBase | osa_circ_005621 |
Alias | Os01circ32515 |
Organism | Oryza sativa |
Position | chr1: 40646235-40646493 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup |
Parent gene | Os01g0926800 |
Parent gene annotation |
Cellular retinaldehyde-binding/triple function, N-terminal domai n containing protein. (Os01t0926800-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/2/3 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0926800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.409497748 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40646305-40646482(+) |
Potential amino acid sequence |
MLLKALRWRREAVPGGSVPEEKVQSDLDDDKVYMGGADRTGRPILLAFPAKHFSAKRDMPKFKR SGQPDAEEVPAGARPQRGEGVGDAAQGAPVEEGGGARRLGARGEGAKRPRRRQGLHGRRRSDRP PHPPRLPRQALLRQTRHA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2016;Chu et al., 2017 |