Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0926800_circ_g.1 |
| ID in PlantcircBase | osa_circ_005621 |
| Alias | Os01circ32515 |
| Organism | Oryza sativa |
| Position | chr1: 40646235-40646493 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup |
| Parent gene | Os01g0926800 |
| Parent gene annotation |
Cellular retinaldehyde-binding/triple function, N-terminal domai n containing protein. (Os01t0926800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2/3 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0926800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.409497748 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40646305-40646482(+) |
| Potential amino acid sequence |
MLLKALRWRREAVPGGSVPEEKVQSDLDDDKVYMGGADRTGRPILLAFPAKHFSAKRDMPKFKR SGQPDAEEVPAGARPQRGEGVGDAAQGAPVEEGGGARRLGARGEGAKRPRRRQGLHGRRRSDRP PHPPRLPRQALLRQTRHA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2016;Chu et al., 2017 |