Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0431100_circ_g.1 |
| ID in PlantcircBase | osa_circ_037139 |
| Alias | Os_ciR11460 |
| Organism | Oryza sativa |
| Position | chr8: 20850178-20851574 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0431100 |
| Parent gene annotation |
Bromo adjacent region domain containing protein. (Os08t0431100-0 1);Bromo adjacent region domain containing protein. (Os08t043110 0-02);Hypothetical conserved gene. (Os08t0431100-03);Hypothetica l conserved gene. (Os08t0431100-04) |
| Parent gene strand | + |
| Alternative splicing | Os08g0431100_circ_g.2 Os08g0431100_circ_g.3 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0431100-01:3 Os08t0431100-02:3 Os08t0431100-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.145559198 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20850202-20850394(+) |
| Potential amino acid sequence |
MSNRFNENPYDDIEFTDVAASKDVSHTSSVRNNSKEFTWLGPAWLCEKRWKHYRSFCRKGITIS VHNFVYILSEEKKRLIAQVEDLYEDTNSTNVVMVRWFDKVDEVGVELPPDVGDREIFFSPGLQD LSVECIDGLAAVLSAQHFEKFQSSPKHSYWQPYICRRQIDEDGVKPFDVTQLQGYWSQEVLRTM FNAASSLKVRFKVTKGASSSDGAQKRKRDAFSETDPQQCVPSAAFGSDSLKNDLEHKTQKQLYP GSRAEVLSQDSGIRGCWFRCFVLKRRGDKIKVRYEDLQDADETGNLEDVITDLLQCLIGSMKIH MMTLSSLMLLLQRMFHIHHQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |