Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0010s00730_circ_g.1 |
| ID in PlantcircBase | pop_circ_002648 |
| Alias | Chr10:428570-428985 |
| Organism | Populus trichocarpa |
| Position | chr10: 429243-429658 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0010s00730 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0010s00730.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.122395533 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
429528-429260(+) 429386-429608(-) |
| Potential amino acid sequence |
MQVSMQRGYENDFFSRKSFRDLGCTDFMIESLKGQVFVRPSHIQVLKLRE*(+) MGSLSASSSSSRKCWCLLNCCFAFLAISFNLCAFSFPKFAATPLVSIPEYEKGAQKPALLKTQS *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |