Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G30070_circ_g.1 |
ID in PlantcircBase | ath_circ_015601 |
Alias | At_ciR1779 |
Organism | Arabidpsis thaliana |
Position | chr2: 12836588-12836848 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT2G30070 |
Parent gene annotation |
Potassium transporter 1 |
Parent gene strand | + |
Alternative splicing | AT2G30070_circ_g.2 AT2G30070_circ_g.3 |
Support reads | 5/16 |
Tissues | leaf/whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G30070.2:1 AT2G30070.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.296970723 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12836776-12836845(+) |
Potential amino acid sequence |
MYKFLRSTGVEGWVSLGGVVLSITDYVVIIACIILVAIFSVQRYGTHRVAFIFAPISTAWLLSI SSIGVYNTIKWNPRIVSALSPVYMYKFLRSTGVEGWVSLGGVVLSITDYVVIIACIILVAIFSV QRYGTHRVAFIFAPISTAWLLSISSIGVYNTIKWNPRIVSALSPVYMYKFLRSTGVEGWVSLGG VVLSITDYVVIIACIILVAIFSVQRYGTHRVAFIFAPISTAWLLSISSIGVYNTIKWNPRIVSA LSPVYMYKFLRSTGVEGWVSLGGVVLSIT(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |