Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0361366_circ_g.2 |
| ID in PlantcircBase | osa_circ_038956 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 11806893-11807759 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0361400 |
| Parent gene annotation |
Outer mitochondrial membrane protein porin (Voltage-dependent an ion- selective channel protein) (VDAC). (Os09t0361400-01);Simila r to Mitochondrial outer membrane protein porin. (Os09t0361400-0 2) |
| Parent gene strand | + |
| Alternative splicing | Os09g0361366_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0361366-00:3 Os09t0361400-02:2 Os09t0361400-01:3 Os09t0361366-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008018* osi_circ_018407 |
| PMCS | 0.128758314 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11807428-11807743(-) |
| Potential amino acid sequence |
MDFNPGVSSSTVTVVTTFESEFAFTSTVMFLFFICDWISPKIRSAFFVLVAVIAGSMTR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |