Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0361366_circ_g.2 |
ID in PlantcircBase | osa_circ_038956 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 11806893-11807759 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0361400 |
Parent gene annotation |
Outer mitochondrial membrane protein porin (Voltage-dependent an ion- selective channel protein) (VDAC). (Os09t0361400-01);Simila r to Mitochondrial outer membrane protein porin. (Os09t0361400-0 2) |
Parent gene strand | + |
Alternative splicing | Os09g0361366_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0361366-00:3 Os09t0361400-02:2 Os09t0361400-01:3 Os09t0361366-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008018* osi_circ_018407 |
PMCS | 0.128758314 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11807428-11807743(-) |
Potential amino acid sequence |
MDFNPGVSSSTVTVVTTFESEFAFTSTVMFLFFICDWISPKIRSAFFVLVAVIAGSMTR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |