Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0671700_circ_g.3 |
ID in PlantcircBase | osa_circ_035233 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 28404979-28405801 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0671700 |
Parent gene annotation |
Similar to Arginine methyltransferase-like protein. (Os07t067170 0-01) |
Parent gene strand | + |
Alternative splicing | Os07g0671700_circ_g.2 Os07g0671700_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0671700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017466 |
PMCS | 0.169381349 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28405019-28405072(+) 28405014-28405741(-) 28405031-28405741(-) |
Potential amino acid sequence |
MAEHAQRLISGNPSLGQRITVIKGKVEEVELPEKADILISEPMGTLLVNERMLESYVIARDRFL VPGGKMFPTTGRLVPDMYMQLRHLKWLNMLSVLFLETHLLDKE*(+) MPQLHIHVWHQPSSCWKHFTTWHKESVSSYNIGLQHPFIHQEGSHRLRNKYVSFLWKFNFLNFA FDDRYSLSKRWVSRNKTLSMFSHFRCLNCIYMSGTSLPVVGNILPPGTRNLSLAIT*(-) MFSHFRCLNCIYMSGTSLPVVGNILPPGTRNLSLAIT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |