Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0671700_circ_g.3 |
| ID in PlantcircBase | osa_circ_035233 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 28404979-28405801 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0671700 |
| Parent gene annotation |
Similar to Arginine methyltransferase-like protein. (Os07t067170 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0671700_circ_g.2 Os07g0671700_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0671700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017466 |
| PMCS | 0.169381349 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28405019-28405072(+) 28405014-28405741(-) 28405031-28405741(-) |
| Potential amino acid sequence |
MAEHAQRLISGNPSLGQRITVIKGKVEEVELPEKADILISEPMGTLLVNERMLESYVIARDRFL VPGGKMFPTTGRLVPDMYMQLRHLKWLNMLSVLFLETHLLDKE*(+) MPQLHIHVWHQPSSCWKHFTTWHKESVSSYNIGLQHPFIHQEGSHRLRNKYVSFLWKFNFLNFA FDDRYSLSKRWVSRNKTLSMFSHFRCLNCIYMSGTSLPVVGNILPPGTRNLSLAIT*(-) MFSHFRCLNCIYMSGTSLPVVGNILPPGTRNLSLAIT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |