Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d010448_circ_g.1 |
ID in PlantcircBase | zma_circ_009667 |
Alias | zma_circ_0002794 |
Organism | Zea mays |
Position | chr8: 115607458-115608442 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d010448 |
Parent gene annotation |
Putative leucine-rich repeat receptor-like protein kinase family protein; Receptor protein kinase-like |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d010448_T003:4 Zm00001d010448_T005:4 Zm00001d010448_T004:4 Zm00001d010448_T002:4 Zm00001d010448_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.104314442 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
115607526-115607513(+) 115607525-115608358(-) |
Potential amino acid sequence |
MTLTMQSVGLSGQLPQKLFSFPQLQHLVLSDNELNGTLDMGNNMSKHLDLVDIQNNKITSVTVY NSFKNLKLEGNPLCNDSLLSDTSPCMGLQTEAPPQPYQFDVQCAYPFIETIVFRAPSFANVFEY LPELQKNLSKQLNSCTPNWLGLVPYFDEDAYLNVNIKACPVKQKRFNYSQVLNCFNLTRQTYKP PEMYGPYYVNAHPYAFHDKRISVITALILLTSQAGSQI*(+) MLFKSENQLGTLEGSKLLLLISFYRGMRKDVHSHSKAHTSRVACKSDGSG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |