Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d039321_circ_g.2 |
ID in PlantcircBase | zma_circ_007461 |
Alias | Zm03circ00001 |
Organism | Zea mays |
Position | chr3: 1757057-1771014 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d039321 |
Parent gene annotation |
SMR domain-containing protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d039321_T003:3 Zm00001d039321_T002:3 Zm00001d039321_T016:1 Zm00001d039321_T009:3 Zm00001d039321_T005:3 Zm00001d039321_T001:1 Zm00001d039321_T008:3 Zm00001d039321_T004:3 Zm00001d039321_T007:3 Zm00001d039321_T006:3 Zm00001d039321_T015:2 Zm00001d039321_T010:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.071418381 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1764447-1757076(+) 1764409-1757062(+) 1764449-1770995(-) |
Potential amino acid sequence |
MFSTEDTPDISSNASKAFSTSYPYWPDLRFTP*(+) MCHSFWHFDGLFPCFQLKTHQIYQAMHPKPSQHRTHTGLI*(+) METNHQSARRNDTCHLDMFSGNGLSVENLTAGNRRSLRQLTDEISNTGLQSELGHEFLWGEPQI RPVWVRC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |