Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0280100_circ_g.2 |
| ID in PlantcircBase | osa_circ_036580 |
| Alias | Os_ciR11336 |
| Organism | Oryza sativa |
| Position | chr8: 10902975-10904166 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0280100 |
| Parent gene annotation |
Similar to Phytase. (Os08t0280100-01);Similar to Phytase. (Os08t 0280100-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0280100-02:2 Os08t0280100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113327111 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10904162-10903412(+) |
| Potential amino acid sequence |
MKVVNSTYALWTWHRNQDAYGEDSVGDQIYIVRQPDKCLLQTTSASSENNCPSEGCPSLVSNSG YGAQKDIIRSGHLIWNASLVIWMILISTVFMKGNLCSRF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |