Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G000300_circ_g.2 |
| ID in PlantcircBase | gra_circ_000904 |
| Alias | Chr09:103319|104034 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 103319-104034 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G000300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.009G000300_circ_g.1 |
| Support reads | 2/10 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G000300.1:2 Gorai.009G000300.3:1 Gorai.009G000300.2:2 Gorai.009G000300.4:1 Gorai.009G000300.5:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.874655319 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
103951-103970(-) |
| Potential amino acid sequence |
MLNNYLKQSLPTRFRMIPANFSKATQSFTQASITTGIRQTKTVIAD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |