Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0294100_circ_g.2 |
| ID in PlantcircBase | osa_circ_011245 |
| Alias | Os_ciR3314 |
| Organism | Oryza sativa |
| Position | chr12: 11426281-11427216 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os12g0294100 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os12t0294100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/2 |
| Tissues | root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0294100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010437 zma_circ_001531 |
| PMCS | 0.233902876 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11426920-11426484(+) 11426306-11427005(-) |
| Potential amino acid sequence |
MNVETSVAKVGFFGNTYQKIWCLSHIETLSTWDWNDGSRELNIDDARSLATDRWNLDHVKFAPH QHSKLISAAVDGLICVFDTDGDMNEDNHLLSVCFSCFLCPNALSYISCYVRLWFDTLMFVVY*( +) MLMWCKFYMVKVPPISCQGTSIIYIQFSTPIIPVPGT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |