Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0294100_circ_g.2 |
ID in PlantcircBase | osa_circ_011245 |
Alias | Os_ciR3314 |
Organism | Oryza sativa |
Position | chr12: 11426281-11427216 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os12g0294100 |
Parent gene annotation |
WD40 repeat-like domain containing protein. (Os12t0294100-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3/2 |
Tissues | root/root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0294100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010437 zma_circ_001531 |
PMCS | 0.233902876 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11426920-11426484(+) 11426306-11427005(-) |
Potential amino acid sequence |
MNVETSVAKVGFFGNTYQKIWCLSHIETLSTWDWNDGSRELNIDDARSLATDRWNLDHVKFAPH QHSKLISAAVDGLICVFDTDGDMNEDNHLLSVCFSCFLCPNALSYISCYVRLWFDTLMFVVY*( +) MLMWCKFYMVKVPPISCQGTSIIYIQFSTPIIPVPGT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |