Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d012518_circ_g.2 |
ID in PlantcircBase | zma_circ_009805 |
Alias | zma_circ_0002921 |
Organism | Zea mays |
Position | chr8: 176006834-176007271 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d012518 |
Parent gene annotation |
2,3-bisphosphoglycerate-independent phosphoglycerate mutase |
Parent gene strand | - |
Alternative splicing | Zm00001d012518_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d012518_T008:2 Zm00001d012518_T002:2 Zm00001d012518_T012:2 Zm00001d012518_T010:2 Zm00001d012518_T009:2 Zm00001d012518_T006:2 Zm00001d012518_T001:2 Zm00001d012518_T014:1 Zm00001d012518_T007:2 Zm00001d012518_T013:2 Zm00001d012518_T011:2 Zm00001d012518_T003:2 Zm00001d012518_T015:2 Zm00001d012518_T004:2 Zm00001d012518_T005:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.227396975 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
176006924-176007268(-) |
Potential amino acid sequence |
MIFWSLERRVLMHKLHLVVEGCMLRWTVMSAKLVDQALASGKIYDGDGFNYIKESFESGTLHLI GLLSDGGVHSRLDQLQLLLKGVSERGAKKIRVHILTDGRDVLDGSSIGFVETLENDLLELRAKG VDAQIASGGGRMYVTMDRYEC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |