Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d011956_circ_g.1 |
ID in PlantcircBase | zma_circ_009777 |
Alias | zma_circ_0002892 |
Organism | Zea mays |
Position | chr8: 165142250-165142604 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d011956 |
Parent gene annotation |
Histone-lysine N-methyltransferase H3 lysine-9 specific SUVH4 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d011956_T009:2 Zm00001d011956_T011:2 Zm00001d011956_T001:2 Zm00001d011956_T012:2 Zm00001d011956_T008:2 Zm00001d011956_T003:2 Zm00001d011956_T010:2 Zm00001d011956_T006:2 Zm00001d011956_T007:2 Zm00001d011956_T002:2 Zm00001d011956_T004:2 Zm00001d011956_T005:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.218689038 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
165142566-165142314(+) |
Potential amino acid sequence |
MSFGIFRDFKYVKPLSDTANPVEMFCLHNHGCSCS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |