Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G05230_circ_g.3 |
ID in PlantcircBase | ath_circ_000786 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 1514862-1514963 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, CIRI-full |
Parent gene | AT1G05230 |
Parent gene annotation |
AT1G05230 protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G05230.6:1 AT1G05230.9:1 AT1G05230.12:1 AT1G05230.11:1 AT1G05230.1:1 AT1G05230.10:1 AT1G05230.7:1 AT1G05230.5:1 AT1G05230.8:1 AT1G05230.4:1 AT1G05230.2:1 AT1G05230.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.238201924 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1514937-1514864(-) |
Potential amino acid sequence |
MVSRAMTLAVLSTGVAGNYNGALQVNQWSTIFAGMVSRAMTLAVLSTGVAGNYNGALQVNQWST IFAGMVSRAMTLAVLSTGVAGNYNGALQVNQWSTIFAGMVSRAMTLAVLSTGVAGNYNGALQV( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |