Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G05230_circ_g.3 |
| ID in PlantcircBase | ath_circ_000786 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 1514862-1514963 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, CIRI-full |
| Parent gene | AT1G05230 |
| Parent gene annotation |
AT1G05230 protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G05230.6:1 AT1G05230.9:1 AT1G05230.12:1 AT1G05230.11:1 AT1G05230.1:1 AT1G05230.10:1 AT1G05230.7:1 AT1G05230.5:1 AT1G05230.8:1 AT1G05230.4:1 AT1G05230.2:1 AT1G05230.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.238201924 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1514937-1514864(-) |
| Potential amino acid sequence |
MVSRAMTLAVLSTGVAGNYNGALQVNQWSTIFAGMVSRAMTLAVLSTGVAGNYNGALQVNQWST IFAGMVSRAMTLAVLSTGVAGNYNGALQVNQWSTIFAGMVSRAMTLAVLSTGVAGNYNGALQV( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |