Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0191500_circ_g.1 |
ID in PlantcircBase | osa_circ_010753 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 4654038-4654223 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os12g0191400 |
Parent gene annotation |
Conserved hypothetical protein. (Os12t0191400-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot, pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0191500-01:1 Os12t0191400-00:1 Os12t0191500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.405236022 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4654042-4654040(-) |
Potential amino acid sequence |
MGCDASVLIRSARNDAEVNNNKHQGLRGQAVVDAAKAELEDQCPGVVSCADIIALAARDAIAMG CDASVLIRSARNDAEVNNNKHQGLRGQAVVDAAKAELEDQCPGVVSCADIIALAARDAIAMGCD ASVLIRSARNDAEVNNNKHQGLRGQAVVDAAKAELEDQCPGVVSCADIIALAARDAIAM(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |