Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0191500_circ_g.1 |
| ID in PlantcircBase | osa_circ_010753 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 4654038-4654223 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os12g0191400 |
| Parent gene annotation |
Conserved hypothetical protein. (Os12t0191400-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0191500-01:1 Os12t0191400-00:1 Os12t0191500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.405236022 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4654042-4654040(-) |
| Potential amino acid sequence |
MGCDASVLIRSARNDAEVNNNKHQGLRGQAVVDAAKAELEDQCPGVVSCADIIALAARDAIAMG CDASVLIRSARNDAEVNNNKHQGLRGQAVVDAAKAELEDQCPGVVSCADIIALAARDAIAMGCD ASVLIRSARNDAEVNNNKHQGLRGQAVVDAAKAELEDQCPGVVSCADIIALAARDAIAM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |