Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G48160_circ_g.1 |
ID in PlantcircBase | ath_circ_018996 |
Alias | At_ciR3910, AT2G48160_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 19691667-19691976 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full, CIRI2 |
Parent gene | AT2G48160 |
Parent gene annotation |
Tudor/PWWP/MBT domain-containing protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G48160.2:2 AT2G48160.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.286735292 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19691974-19691669(-) |
Potential amino acid sequence |
MEILAHTLESESNLKRRVDLFFLVDSIAQCSKGLKGDTGCVYLSAIQVILPRLLAAAVPAGATT QENRKQCLKAMEILAHTLESESNLKRRVDLFFLVDSIAQCSKGLKGDTGCVYLSAIQVILPRLL AAAVPAGATTQENRKQCLKAMEILAHTLESESNLKRRVDLFFLVDSIAQCSKGLKGDTGCVYLS AIQVILPRLLAAAVPAGATTQENRKQCLKAMEILAHTLESESNLKRRVDLFFLVDSIAQCSKGL KGDTGCVYLSAIQVILPRLLAAAVPAGATTQENRKQCLK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Zhang et al., 2019 |