Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G48160_circ_g.1 |
| ID in PlantcircBase | ath_circ_018996 |
| Alias | At_ciR3910, AT2G48160_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 19691667-19691976 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full, CIRI2 |
| Parent gene | AT2G48160 |
| Parent gene annotation |
Tudor/PWWP/MBT domain-containing protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G48160.2:2 AT2G48160.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.286735292 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19691974-19691669(-) |
| Potential amino acid sequence |
MEILAHTLESESNLKRRVDLFFLVDSIAQCSKGLKGDTGCVYLSAIQVILPRLLAAAVPAGATT QENRKQCLKAMEILAHTLESESNLKRRVDLFFLVDSIAQCSKGLKGDTGCVYLSAIQVILPRLL AAAVPAGATTQENRKQCLKAMEILAHTLESESNLKRRVDLFFLVDSIAQCSKGLKGDTGCVYLS AIQVILPRLLAAAVPAGATTQENRKQCLKAMEILAHTLESESNLKRRVDLFFLVDSIAQCSKGL KGDTGCVYLSAIQVILPRLLAAAVPAGATTQENRKQCLK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Zhang et al., 2019 |