Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0438000_circ_g.4 |
| ID in PlantcircBase | osa_circ_039316 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 16187595-16187922 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0438000 |
| Parent gene annotation |
Similar to RbohAOsp (Fragment). (Os09t0438000-01);Similar to Res piratory burst oxidase-like protein E. (Os09t0438000-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0438000_circ_g.5 Os09g0438000_circ_g.6 Os09g0438000_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0438000-02:2 Os09t0438000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215993674 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16187885-16187918(+) 16187887-16187884(-) |
| Potential amino acid sequence |
MEELDPENLGYIEGGHQRGWEDNEGGSTGADRPERVGEQAGEAEGASGGVRVAHHGGARPGEPR LH*(+) MMSDAYSSACSFSFASLFADALRTISSCTSSLVILPSTLVSTLNVAEVLRVELLHDERRVLLRL LLQLRQLVRRRAQDDQLLYFLPRYPPIHVGVHPQCSRGSPGRAPP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |