Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0639100_circ_g.1 |
ID in PlantcircBase | osa_circ_015741 |
Alias | Os02circ19870 |
Organism | Oryza sativa |
Position | chr2: 25639659-25639803 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0639100 |
Parent gene annotation |
Similar to H0801D08.12 protein. (Os02t0639100-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0639100-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.248016954 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25639798-25639788(-) 25639752-25639788(-) |
Potential amino acid sequence |
MAPEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIRSGMFLVRQWLHGT*(-) MSTASECSFLRSSVEGGCRRPFDQACFSCGSGYMAPEYVVHGQLTKKADVYSFGVLILEIISGR RMSQTIRSGMFLVRQWLHGT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |