Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0639100_circ_g.1 |
| ID in PlantcircBase | osa_circ_015741 |
| Alias | Os02circ19870 |
| Organism | Oryza sativa |
| Position | chr2: 25639659-25639803 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0639100 |
| Parent gene annotation |
Similar to H0801D08.12 protein. (Os02t0639100-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0639100-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.248016954 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25639798-25639788(-) 25639752-25639788(-) |
| Potential amino acid sequence |
MAPEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIRSGMFLVRQWLHGT*(-) MSTASECSFLRSSVEGGCRRPFDQACFSCGSGYMAPEYVVHGQLTKKADVYSFGVLILEIISGR RMSQTIRSGMFLVRQWLHGT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |