Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G28520_circ_g.2 |
| ID in PlantcircBase | ath_circ_004708 |
| Alias | At_ciR418, AT1G28520_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 10029674-10029943 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT1G28520 |
| Parent gene annotation |
Transcription factor VOZ1 |
| Parent gene strand | + |
| Alternative splicing | AT1G28520_circ_g.3 AT1G28520_circ_g.4 |
| Support reads | 31/13 |
| Tissues | leaf/leaf, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G28520.5:1 AT1G28520.4:1 AT1G28520.1:1 AT1G28520.3:1 AT1G28520.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.791283838 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10029713-10029940(+) |
| Potential amino acid sequence |
MTGKRSKTNCRSASHKLFKDKAKNRVDDLQGMLLDLQFARKESRPTDVTLLEEQVNQMLREWKS ELNEPSPASSLQQRILCFCGGEVRFLMTGKRSKTNCRSASHKLFKDKAKNRVDDLQGMLLDLQF ARKESRPTDVTLLEEQVNQMLREWKSELNEPSPASSLQQRILCFCGGEVRFLMTGKRSKTNCRS ASHKLFKDKAKNRVDDLQGMLLDLQFARKESRPTDVTLLEEQVNQMLREWKSELNEPSPASSLQ QRILCFCGGEVRFLMTGKRSKTNCRSASHKLFKDKAKNRVDDLQGMLLDLQFARKESRPTDVTL LEEQVNQMLREWKSELNEPSPASSLQQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |