Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d006875_circ_g.1 |
| ID in PlantcircBase | zma_circ_007389 |
| Alias | zma_circ_0000931 |
| Organism | Zea mays |
| Position | chr2: 218328810-218329095 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d006875 |
| Parent gene annotation |
alanine aminotransferase10 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d006875_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.252498747 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
218329051-218329063(-) |
| Potential amino acid sequence |
MKGSFFSRMRFTKKTYMSKTSNSTRSKKSHGRWDTLMTTFLWYRSSRFLKVLTEENQKKIVEFC KNERLVLLADEVYQENIYVEDKQFHSFKKIARSLGYTDDDLPLVSFQSISKGPYRGKPEENC*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |