Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d054001_circ_g.1 |
ID in PlantcircBase | zma_circ_008324 |
Alias | zma_circ_0001753 |
Organism | Zea mays |
Position | chr4: 244895306-244895523 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d054001 |
Parent gene annotation |
Protein arginine N-methyltransferase 1.5 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d054001_T021:2 Zm00001d054001_T003:1 Zm00001d054001_T009:2 Zm00001d054001_T004:2 Zm00001d054001_T017:2 Zm00001d054001_T028:2 Zm00001d054001_T008:1 Zm00001d054001_T010:1 Zm00001d054001_T027:2 Zm00001d054001_T005:1 Zm00001d054001_T007:1 Zm00001d054001_T006:2 Zm00001d054001_T029:1 Zm00001d054001_T025:2 Zm00001d054001_T024:2 Zm00001d054001_T015:2 Zm00001d054001_T022:2 Zm00001d054001_T023:2 Zm00001d054001_T018:2 Zm00001d054001_T020:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.032874618 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
244895369-244895326(+) 244895328-244895358(-) |
Potential amino acid sequence |
MDPLPEQERIEINYRDFLQSPLQIPVFDMH*(+) MHVEHGNLQRRLQKVPVINLNAFLLRKRIHLPI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |