Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0662000_circ_g.4 |
| ID in PlantcircBase | osa_circ_031857 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 27288500-27288604 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0662000 |
| Parent gene annotation |
Vacuolar-type H+-ATPase subunit A1, Premature leaf senescence an d seed dormancy, Regulation of stomatal aperture and density (Os 06t0662000-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0662000_circ_g.3 Os06g0662000_circ_g.5 Os06g0662000_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0662000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.295236825 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27288515-27288516(-) |
| Potential amino acid sequence |
MKLSRLWNPSMRSLIKISLILEQKLVKCYRERTI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |