Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0133000_circ_g.1 |
ID in PlantcircBase | osa_circ_035748 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 1844379-1845760 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0133000 |
Parent gene annotation |
Protein of unknown function DUF1637 family protein. (Os08t013300 0-01) |
Parent gene strand | + |
Alternative splicing | Os08g0133000_circ_ag.1 Os08g0133000_circ_ag.2 Os08g0133000_circ_ag.3 Os08g0133200_circ_igg.1 Os08g0133600_circ_g.1 Os08g0133600_circ_igg.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0133000-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.135254118 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1844731-1844462(+) 1844504-1845755(-) |
Potential amino acid sequence |
MTVLSKLLYGSMHVKSYDWVEPAVLANGKPVKLGKLHTDDVLNAPCPTAVLYPQSGGNMHCFTS VKSCAVLDVIAPPYSESSGRVCTYFHDYPFSSFSAGQAKVVHGPDNYAWLEALIVPVNINMRPG TYTGPTIQIQSLLWMLDSEMIILRMEEDLGSLNQTS*(+) MGCAHLATLAEFFKKFDSKNPNPLPSSRLSSLSPTSTGVIVSV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |