Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d044222_circ_g.2 |
ID in PlantcircBase | zma_circ_007876 |
Alias | zma_circ_0001359, GRMZM2G047093_C1 |
Organism | Zea mays |
Position | chr3: 222355277-222358096 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d044222 |
Parent gene annotation |
tetratricopeptide repeat (TPR)-containing protein |
Parent gene strand | + |
Alternative splicing | Zm00001d044222_circ_g.1 Zm00001d044222_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d044222_T013:7 Zm00001d044222_T029:7 Zm00001d044222_T032:7 Zm00001d044222_T017:7 Zm00001d044222_T020:7 Zm00001d044222_T005:8 Zm00001d044222_T004:7 Zm00001d044222_T016:7 Zm00001d044222_T030:6 Zm00001d044222_T011:7 Zm00001d044222_T025:7 Zm00001d044222_T009:7 Zm00001d044222_T034:7 Zm00001d044222_T002:6 Zm00001d044222_T027:7 Zm00001d044222_T022:7 Zm00001d044222_T031:7 Zm00001d044222_T003:7 Zm00001d044222_T012:6 Zm00001d044222_T026:8 Zm00001d044222_T036:4 Zm00001d044222_T021:8 Zm00001d044222_T038:2 Zm00001d044222_T001:6 Zm00001d044222_T008:7 Zm00001d044222_T023:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.064858026 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
222355455-222355331(+) |
Potential amino acid sequence |
MKGLTLNCMDRKSEAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNI EILRDLSLLQAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAVEVLEAYEGTL EDDYPPENERYEHNEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMASVLFKLGRF DESESIYRSLLFMNPDNYKNPTRLSNIRKGLRLQIPY*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |