Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0241600_circ_g.1 |
| ID in PlantcircBase | osa_circ_036444 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 8590661-8592396 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os08g0241600 |
| Parent gene annotation |
Similar to apospory-associated protein C. (Os08t0241600-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0241600_circ_g.2 Os08g0241600_circ_g.3 Os08g0241600_circ_g.4 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0241600-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.176301949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8592231-8590678(+) 8592354-8590694(+) |
| Potential amino acid sequence |
MLFKISMCSKLGEANGYPTTNGFWRFENSLYKTQK*(+) MGIPPRMAFGGLKIACTRRRNENSQP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |