Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0636700_circ_g.4 |
ID in PlantcircBase | osa_circ_002840 |
Alias | Os_ciR4470 |
Organism | Oryza sativa |
Position | chr1: 25525102-25525572 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os01g0636700 |
Parent gene annotation |
DEAD-like helicase, N-terminal domain containing protein. (Os01t 0636700-01) |
Parent gene strand | - |
Alternative splicing | Os01g0636600_circ_ag.1 Os01g0636600_circ_ag.2 Os01g0636600_circ_g.1 Os01g0636600_circ_ag.2 Os01g0636600_circ_ag.3 Os01g0636600_circ_ag.4 Os01g0636600_circ_ag.5 Os01g0636600_circ_ag.6 Os01g0636700_circ_g.1 Os01g0636700_circ_g.2 Os01g0636700_circ_g.3 Os01g0636700_circ_g.5 Os01g0636700_circ_g.6 Os01g0637300_circ_ig.1 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0636700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010401 |
PMCS | 0.112880255 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25525528-25525118(+) 25525544-25525556(-) |
Potential amino acid sequence |
MFRNPSQEVLKILCNPIYATI*(+) MGFGTSLLQKRLEIETMTDNIRATLKSHLIFLRQQGIVGVSVHNTLFEKTINLPPQKIDMKYLP PQKIDMGDENRSTVGHSRSQHRRSLSDSCIDWVTKNF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |