Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0636700_circ_g.4 |
| ID in PlantcircBase | osa_circ_002840 |
| Alias | Os_ciR4470 |
| Organism | Oryza sativa |
| Position | chr1: 25525102-25525572 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0636700 |
| Parent gene annotation |
DEAD-like helicase, N-terminal domain containing protein. (Os01t 0636700-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0636600_circ_ag.1 Os01g0636600_circ_ag.2 Os01g0636600_circ_g.1 Os01g0636600_circ_ag.2 Os01g0636600_circ_ag.3 Os01g0636600_circ_ag.4 Os01g0636600_circ_ag.5 Os01g0636600_circ_ag.6 Os01g0636700_circ_g.1 Os01g0636700_circ_g.2 Os01g0636700_circ_g.3 Os01g0636700_circ_g.5 Os01g0636700_circ_g.6 Os01g0637300_circ_ig.1 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0636700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010401 |
| PMCS | 0.112880255 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25525528-25525118(+) 25525544-25525556(-) |
| Potential amino acid sequence |
MFRNPSQEVLKILCNPIYATI*(+) MGFGTSLLQKRLEIETMTDNIRATLKSHLIFLRQQGIVGVSVHNTLFEKTINLPPQKIDMKYLP PQKIDMGDENRSTVGHSRSQHRRSLSDSCIDWVTKNF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |