Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G18590_circ_g.12 |
| ID in PlantcircBase | ath_circ_039033 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 6181334-6181616 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | AT5G18590 |
| Parent gene annotation |
Galactose oxidase/kelch repeat superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT5G18590_circ_g.13 |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G18590.1:2 AT5G18590.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.241321541 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6181539-6181336(-) |
| Potential amino acid sequence |
MVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQNEAAVAATSYSDELDFQPSSGNS ENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQNEAAVAATSYSDELDFQPSS GNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQNEAAVAATSYSDELDFQ PSSGNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |