Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G18590_circ_g.12 |
ID in PlantcircBase | ath_circ_039033 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 6181334-6181616 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | AT5G18590 |
Parent gene annotation |
Galactose oxidase/kelch repeat superfamily protein |
Parent gene strand | - |
Alternative splicing | AT5G18590_circ_g.13 |
Support reads | 3 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G18590.1:2 AT5G18590.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.241321541 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6181539-6181336(-) |
Potential amino acid sequence |
MVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQNEAAVAATSYSDELDFQPSSGNS ENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQNEAAVAATSYSDELDFQPSS GNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQNEAAVAATSYSDELDFQ PSSGNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |