Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0688100_circ_g.8 |
| ID in PlantcircBase | osa_circ_032123 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 28704610-28705119 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0688100 |
| Parent gene annotation |
Hypothetical conserved gene. (Os06t0688100-01);RNA polymerase I specific transcription initiation factor RRN3 family protein. (O s06t0688100-02);RNA polymerase I specific transcription initiati on factor RRN3 domain containing protein. (Os06t0688100-03);Hypo thetical conserved gene. (Os06t0688100-04) |
| Parent gene strand | + |
| Alternative splicing | Os06g0688100_circ_g.5 Os06g0688100_circ_g.6 Os06g0688100_circ_g.7 Os06g0688100_circ_g.9 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0688100-02:3 Os06t0688100-01:2 Os06t0688100-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016574 |
| PMCS | 0.153907745 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28704612-28704666(+) 28704628-28705046(-) |
| Potential amino acid sequence |
MSAVSYVGSYLSRARFISADTVVGILKRLVDWCVDYCDLQNNIRITTKPINHQIFYASCQAVMY ILCFRLRSIMDYPNLKAQLFNMPFGYILTHPLEPLKNVCSFICWKLFVSGKVHFC*(+) MKLQTFFKGSSGCVKIYPNGMLKSCALRFG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |