Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0121700_circ_g.1 |
ID in PlantcircBase | osa_circ_026365 |
Alias | Os_ciR1877 |
Organism | Oryza sativa |
Position | chr5: 1185179-1185821 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os05g0121700 |
Parent gene annotation |
DNA repair and recombination, RecA-like domain containing protei n. (Os05t0121700-01);DNA repair and recombination, RecA-like dom ain containing protein. (Os05t0121700-02) |
Parent gene strand | - |
Alternative splicing | Os05g0121700_circ_g.2 Os05g0121700_circ_g.3 Os05g0121700_circ_g.4 |
Support reads | 6 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0121700-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005921* osi_circ_015241 |
PMCS | 0.318833333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1185204-1185818(+) |
Potential amino acid sequence |
MSSRMESCMSLIISHLCHPWGLKKYLQFLYCNLNSTPHYQMSSRMESCMSLIISHLCHPWGLKK YLQFLYCNLNSTPHYQMSSRMESCMSLIISHLCHPWGLKKYLQFLYCNLNSTPHYQMSSRMESC MSLIISHLCHPWGLKKYLQFLYCN(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |