Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0121700_circ_g.1 |
| ID in PlantcircBase | osa_circ_026365 |
| Alias | Os_ciR1877 |
| Organism | Oryza sativa |
| Position | chr5: 1185179-1185821 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0121700 |
| Parent gene annotation |
DNA repair and recombination, RecA-like domain containing protei n. (Os05t0121700-01);DNA repair and recombination, RecA-like dom ain containing protein. (Os05t0121700-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0121700_circ_g.2 Os05g0121700_circ_g.3 Os05g0121700_circ_g.4 |
| Support reads | 6 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0121700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005921* osi_circ_015241 |
| PMCS | 0.318833333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1185204-1185818(+) |
| Potential amino acid sequence |
MSSRMESCMSLIISHLCHPWGLKKYLQFLYCNLNSTPHYQMSSRMESCMSLIISHLCHPWGLKK YLQFLYCNLNSTPHYQMSSRMESCMSLIISHLCHPWGLKKYLQFLYCNLNSTPHYQMSSRMESC MSLIISHLCHPWGLKKYLQFLYCN(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |