Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa1G629080_circ_g.2 |
| ID in PlantcircBase | csa_circ_000616 |
| Alias | Chr1:24881078_24881449 |
| Organism | Cucumis sativus |
| Position | chrChr1: 24881078-24881449 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2;Find_circ |
| Parent gene | Csa1G629080 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Csa1G629080_circ_g.7 Csa1G629080_circ_g.8 Csa1G629080_circ_g.9 Csa1G629080_circ_g.10 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa1G629080.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.383554928 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24881382-24881385(-) 24881140-24881408(-) |
| Potential amino acid sequence |
MSSGQFNNSRGMDSKTRAELEEIALAEADVARLKQKVAELHHQLNQQRQHNYGSLSDACDRYQH VQNHGSQLFQDYKSNCKQKEILELLWKLA* MVLYLMHVTDISMFRIMAPNCFKITRAIASRKRS* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019;He et al., 2020 |