Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G51310_circ_g.7 |
ID in PlantcircBase | ath_circ_026937 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 19046614-19046679 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G51310 |
Parent gene annotation |
Vacuolar protein sorting-associated protein 35C |
Parent gene strand | - |
Alternative splicing | AT3G51310_circ_g.3 AT3G51310_circ_g.4 AT3G51310_circ_g.5 AT3G51310_circ_g.6 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G51310.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.109848483 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19046647-19046616(-) 19046645-19046676(+) |
Potential amino acid sequence |
MKDFDGTIDDEVDALFELAKGLMKDFDGTIDDEVDALFELAKGLMKDFDGTIDDEVDALFELAK GLMKDFDGTIDDE(-) MRPFASSNNASTSSSIVPSKSFMRPFASSNNASTSSSIVPSKSFMRPFASSNNASTSSSIVPSK SFMRPFASSNNAS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |