Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0238900_circ_g.1 |
ID in PlantcircBase | osa_circ_001002 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 7679974-7682149 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0238900 |
Parent gene annotation |
Similar to Protein SOF1. (Os01t0238900-01) |
Parent gene strand | + |
Alternative splicing | Os01g0238900_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0238900-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.120379699 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7680172-7680055(+) |
Potential amino acid sequence |
MDGHVDAVSCMAKNPNYLKAIFSGSMDGDIRLWDIAARKTVCQFPGHQGAVRGLATSTDGDLLV SCGVDCTVRLWKVPMLKMVDTNDAIGDASQPSAVYTWKHAFWGVDHQWDGNLFATVGAQVDIWD QNRSEPINSFEWGKDTVLSVRFNPGEPDVLITSARKYSAIMIQHFVLRRKRLNTPGLLMLRS*( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |