Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G47310_circ_g.1 |
ID in PlantcircBase | ath_circ_006130 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 17343278-17343595 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
Parent gene | AT1G47310 |
Parent gene annotation |
At1g47310 |
Parent gene strand | + |
Alternative splicing | 1_circ_ag.2 AT1G47270_circ_g.1 AT1G47270_circ_g.2 AT1G47270_circ_g.3 AT1G47271_circ_g.1 AT1G47278_circ_g.1 AT1G47290_circ_g.1 AT1G47290_circ_g.2 AT1G47290_circ_g.3 AT1G47330_circ_g.1 AT1G47330_circ_g.2 AT1G47330_circ_g.3 AT1G47380_circ_g.1 AT1G47380_circ_g.2 AT1G47420_circ_g.1 AT1G47420_circ_g.2 AT1G47420_circ_g.3 AT1G47420_circ_g.4 |
Support reads | 22 |
Tissues | root, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G47310.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.415230148 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17343424-17343280(-) |
Potential amino acid sequence |
MNTNLLFPNRIRISNLRLVPIRIFLTSNFENLTSSRFHFCFTDISFSTSGNESERRSLPSTSSS NGPFNTSGGSRTLLELTSRTSSCNSTSLPPPLLLQSVISSGKMNTNLLFPNRIRISNLRLVPIR IFLTSNFENLTSSRFHFCFTDISFSTSGNESERRSLPSTSSSNGPFNTSGGSRTLLELTSRTSS CNSTSLPPPLLLQSVISSGKMNTNLLFPNRIRISNLRLVPIRIFLTSNFENLTSSRFHFCFTDI SFSTSGNESERRSLPSTSSSNGPFNTSGGSRTLLELTSRTSSCNSTSLPPPLLLQSVISSGKMN TNLLFPNRIRISNLRLVPIRIFLTSNFENLTSSRFHFCFTDISFST(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |