Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G47310_circ_g.1 |
| ID in PlantcircBase | ath_circ_006130 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17343278-17343595 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
| Parent gene | AT1G47310 |
| Parent gene annotation |
At1g47310 |
| Parent gene strand | + |
| Alternative splicing | 1_circ_ag.2 AT1G47270_circ_g.1 AT1G47270_circ_g.2 AT1G47270_circ_g.3 AT1G47271_circ_g.1 AT1G47278_circ_g.1 AT1G47290_circ_g.1 AT1G47290_circ_g.2 AT1G47290_circ_g.3 AT1G47330_circ_g.1 AT1G47330_circ_g.2 AT1G47330_circ_g.3 AT1G47380_circ_g.1 AT1G47380_circ_g.2 AT1G47420_circ_g.1 AT1G47420_circ_g.2 AT1G47420_circ_g.3 AT1G47420_circ_g.4 |
| Support reads | 22 |
| Tissues | root, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G47310.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.415230148 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17343424-17343280(-) |
| Potential amino acid sequence |
MNTNLLFPNRIRISNLRLVPIRIFLTSNFENLTSSRFHFCFTDISFSTSGNESERRSLPSTSSS NGPFNTSGGSRTLLELTSRTSSCNSTSLPPPLLLQSVISSGKMNTNLLFPNRIRISNLRLVPIR IFLTSNFENLTSSRFHFCFTDISFSTSGNESERRSLPSTSSSNGPFNTSGGSRTLLELTSRTSS CNSTSLPPPLLLQSVISSGKMNTNLLFPNRIRISNLRLVPIRIFLTSNFENLTSSRFHFCFTDI SFSTSGNESERRSLPSTSSSNGPFNTSGGSRTLLELTSRTSSCNSTSLPPPLLLQSVISSGKMN TNLLFPNRIRISNLRLVPIRIFLTSNFENLTSSRFHFCFTDISFST(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |