Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G30310_circ_g.7 |
ID in PlantcircBase | ath_circ_033647 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 14833284-14833626 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G30310 |
Parent gene annotation |
FGGY family of carbohydrate kinase |
Parent gene strand | + |
Alternative splicing | AT4G30310_circ_g.1 AT4G30310_circ_g.2 AT4G30310_circ_g.3 AT4G30310_circ_g.4 AT4G30310_circ_g.5 AT4G30310_circ_g.6 AT4G30310_circ_g.8 AT4G30310_circ_g.9 AT4G30310_circ_g.10 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G30310.2:2 AT4G30310.1:2 AT4G30310.4:2 AT4G30310.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.160348641 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14833590-14833623(+) |
Potential amino acid sequence |
MESKLESDSLTKGRSVAFPGHPLGNGLTATAAKELGLLAGTPVGTSLIDAHAGGVGVMESKLES DSLTKGRSVAFPGHPLGNGLTATAAKELGLLAGTPVGTSLIDAHAGGVGVMESKLESDSLTKGR SVAFPGHPLGNGLTATAAKELGLLAGTPVGTSLIDAHAGGVGVMESKLESDSLTK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |