Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0001s20720_circ_g.1 |
ID in PlantcircBase | pop_circ_000218 |
Alias | Chr01:19467224-19467832 |
Organism | Populus trichocarpa |
Position | chr1: 18827725-18828333 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | POPTR_0001s20720 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | POPTR_0001s20720_circ_g.2 |
Support reads | NA |
Tissues | stem xylem |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | POPTR_0001s20720.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.193824165 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18828296-18827970(+) 18828326-18828323(-) 18827832-18828274(-) |
Potential amino acid sequence |
MLSFETFQFHVLLLNWVTKWCKKIEASSLARSSPGHNLCPPPNGVKLPLMLISLSCHLHGLNS* (+) MKLKSLKAQHGEPLCWTDYLSLPFTQTVITETLRMGNIIIGVMRKAMKDTEIKGYLIPKGWCAF AYFRSVHLDENNYEWPYEFNPWRWQDKDMSINGSFTPFGGGQRLCPGLDLARLEASIFLHHFVT QFRRRT*(-) MAASLHLEEDKDYVLDLTSPGWKLQSSCTTLSPSSEGEHEIEKSQSSAWGAIVLD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Liu et al., 2021 |