Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0378200_circ_g.2 |
ID in PlantcircBase | osa_circ_023555 |
Alias | Os_ciR4794 |
Organism | Oryza sativa |
Position | chr4: 18469550-18469979 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0378200 |
Parent gene annotation |
Sterile alpha motif SAM domain containing protein. (Os04t0378200 -01) |
Parent gene strand | + |
Alternative splicing | Os04g0378200_circ_g.3 Os04g0378200_circ_g.4 Os04g0378200_circ_g.5 |
Support reads | 4/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0378066-00:2 Os04t0378066-00:2 Os04t0378200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007486* |
PMCS | 0.511615097 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18469810-18469561(+) 18469582-18469890(-) |
Potential amino acid sequence |
MLSGTMHPQPVNADPPKAKPSSEIVKVTRRENADVMPVRQSKKVPKPTSSKKTSQPKATAN*(+ ) MLPFFISLPLPSAEMSSSMTSVLVLSYFDVQALHLHFHAL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |