Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0378200_circ_g.2 |
| ID in PlantcircBase | osa_circ_023555 |
| Alias | Os_ciR4794 |
| Organism | Oryza sativa |
| Position | chr4: 18469550-18469979 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0378200 |
| Parent gene annotation |
Sterile alpha motif SAM domain containing protein. (Os04t0378200 -01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0378200_circ_g.3 Os04g0378200_circ_g.4 Os04g0378200_circ_g.5 |
| Support reads | 4/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0378066-00:2 Os04t0378066-00:2 Os04t0378200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007486* |
| PMCS | 0.511615097 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18469810-18469561(+) 18469582-18469890(-) |
| Potential amino acid sequence |
MLSGTMHPQPVNADPPKAKPSSEIVKVTRRENADVMPVRQSKKVPKPTSSKKTSQPKATAN*(+ ) MLPFFISLPLPSAEMSSSMTSVLVLSYFDVQALHLHFHAL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |