Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0105100_circ_g.4 |
| ID in PlantcircBase | osa_circ_012653 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 282315-282923 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0105100 |
| Parent gene annotation |
Sec16, central conserved domain domain containing protein. (Os02 t0105100-01);Hypothetical conserved gene. (Os02t0105100-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0105100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012049 |
| PMCS | 0.266060714 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
282793-282470(+) 282866-282339(+) |
| Potential amino acid sequence |
MAHCHFLSGSPLRTLCLLIAGQPADVFNADNNISSNYGSQQPMEDTDGPEMAVTKLFSSCKRSS FQMGDFGSHVRCMKNIPSENQMQVIAIYIIWM*(+) MFLMQTTTSVAIMVLNSLWRTQTVQKWQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |