Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0105100_circ_g.4 |
ID in PlantcircBase | osa_circ_012653 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 282315-282923 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0105100 |
Parent gene annotation |
Sec16, central conserved domain domain containing protein. (Os02 t0105100-01);Hypothetical conserved gene. (Os02t0105100-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0105100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012049 |
PMCS | 0.266060714 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
282793-282470(+) 282866-282339(+) |
Potential amino acid sequence |
MAHCHFLSGSPLRTLCLLIAGQPADVFNADNNISSNYGSQQPMEDTDGPEMAVTKLFSSCKRSS FQMGDFGSHVRCMKNIPSENQMQVIAIYIIWM*(+) MFLMQTTTSVAIMVLNSLWRTQTVQKWQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |