Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0116400_circ_g.4 |
ID in PlantcircBase | osa_circ_038438 |
Alias | NA, |
Organism | Oryza sativa |
Position | chr9: 1304055-1304657 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI-long |
Parent gene | Os09g0116400 |
Parent gene annotation |
CCAAT-binding factor domain containing protein. (Os09t0116400-01 );Similar to predicted protein. (Os09t0116400-02) |
Parent gene strand | + |
Alternative splicing | Os09g0116400_circ_g.3 Os09g0116400_circ_g.5 Os09g0116400_circ_g.6 |
Support reads | 1 |
Tissues | shoot, root, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0116400-02:3 Os09t0116400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.140014608 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1304383-1304654(+) 1304600-1304070(+) |
Potential amino acid sequence |
MKMVVIDEVDSFLFRPHVGLRAKYQATVFILLKEKAEQERRLLTALVNKLGDPERRAASSAAYL LTSLLSAHPNMKMVVIDEVDSFLFRPHVGLRAKYQATVFILLKEKAEQERRLLTALVNKLGDPE RRAASSAAYLLTSLLSAHPNMKMVVIDEVDSFLFRPHVGLRAKYQATVFILLKEKAEQERRLLT ALVNKLGDPERRAASSAAYLLTSLLSAHPNMKMVVIDEVDSFLFRPHVGLRAKYQA(+) MRWTHFSFGHMLVLGPNTKLRFLSF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017; this study |