Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0116400_circ_g.4 |
| ID in PlantcircBase | osa_circ_038438 |
| Alias | NA, |
| Organism | Oryza sativa |
| Position | chr9: 1304055-1304657 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI-long |
| Parent gene | Os09g0116400 |
| Parent gene annotation |
CCAAT-binding factor domain containing protein. (Os09t0116400-01 );Similar to predicted protein. (Os09t0116400-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0116400_circ_g.3 Os09g0116400_circ_g.5 Os09g0116400_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot, root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0116400-02:3 Os09t0116400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.140014608 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1304383-1304654(+) 1304600-1304070(+) |
| Potential amino acid sequence |
MKMVVIDEVDSFLFRPHVGLRAKYQATVFILLKEKAEQERRLLTALVNKLGDPERRAASSAAYL LTSLLSAHPNMKMVVIDEVDSFLFRPHVGLRAKYQATVFILLKEKAEQERRLLTALVNKLGDPE RRAASSAAYLLTSLLSAHPNMKMVVIDEVDSFLFRPHVGLRAKYQATVFILLKEKAEQERRLLT ALVNKLGDPERRAASSAAYLLTSLLSAHPNMKMVVIDEVDSFLFRPHVGLRAKYQA(+) MRWTHFSFGHMLVLGPNTKLRFLSF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017; this study |