Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0555200_circ_g.3 |
| ID in PlantcircBase | osa_circ_034223 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 22115852-22116152 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0555200 |
| Parent gene annotation |
Similar to Eukaryotic translation initiation factor 4g (Fragment ). (Os07t0555200-01);Similar to Eukaryotic translation initiatio n factor 4g (Fragment). (Os07t0555200-02);Similar to predicted p rotein. (Os07t0555200-03);Similar to predicted protein. (Os07t05 55200-04);Similar to predicted protein. (Os07t0555200-05) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0555200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215182724 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22116124-22115917(+) 22116098-22115979(-) |
| Potential amino acid sequence |
MNGGTGGSTMIRLEREHPPYHLPARTRPMRHH*(+) MLHLLVLLVKWTCLKSLMVPLERHEEYLSVVAHWPCSRWKVVGWVLALQTDHCATTSSTIHWET AKLKIICSTFWCSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |